HOME | DD
adrianaTheGirlOnFire — Bippity Boppity Disney Lumiere Entry
#disneyprincess #lumieredisney #yellowdress #dressupgames #lumierebeautyandthebeast #snowqueenmaker #azaleadollsgames #lumierebelle #dollsdomaingroup #weeklymodelchallenge #disneychellenge #dressbasedoflumiere #bippityboppitydisneychallengeweeklytheme #disneycaracther
Published: 2016-09-09 06:41:03 +0000 UTC; Views: 1585; Favourites: 40; Downloads: 2
Redirect to original
Description
so this is my entry for the weekly challenge doll-makers-domain.deviantart.… i was assigned lumiere from beauty and the beast,so i tried to recreate a dress based of lumiere, it was pretty easy and fun to do, not too complicated, i had the idea of how to do the dress some days ago, the dress its like its his body,and she is holding flames,and has one as her headpiece, i gave her nails,and make up and i added patters and details on the dress to make it less simple... i did her her based of belle hair xD and i think thats all, i like how she looks,i used a lot of drags and drops for the details etc.. this is the game i used www.azaleasdolls.com/dressupga…these are the other participants:
Related content
Comments: 14
You got red hair from Lumiere? Great because Lumiere is a redhead as a human.
👍: 0 ⏩: 1
ahhah true omg lool , no , i chose this model, i cant change her hair color, ahaha so good thing she is ginger ahah,she could be his kid lol
👍: 0 ⏩: 0
Shiny! Shiny!! Shiny!!! Wow this is just so sparkly! I love all the little touches that you added to really make this after lumiere's design. Oooooo... fire hands too. I likey! Lol, sorry! I like that you choose to have a pattern on the dress and not have it just solid gold. It gives a nice texture and body to the design. I love the sleeves. And awesome job on the base of the dress.
👍: 0 ⏩: 1
thank you so much :3 yeha i didnt want it to be so simply 
👍: 0 ⏩: 0
omg how beautiful!!!
Loveeee how you did the bottom of the skirt!
and the whole dress!looks gorgeous on her!
amazing work my friend!!!
👍: 0 ⏩: 1
thank you :3 im happy u liked it
👍: 0 ⏩: 0
You're welcome. ^^
👍: 0 ⏩: 0
You're welcome!
👍: 0 ⏩: 0